Poem A Day Open in app

Classic poem

This Is No Case of Petty Right or Wrong

by Edward Thomas

THIS is no case of petty right or wrong

That politicians or philosophers

Can judge. I hate not Germans, nor grow hot

With love of Englishmen, to please newspapers.

Beside my hate for one fat patriot

My hatred of the Kaiser is love true:--

A kind of god he is, banging a gong.

But I have not to choose between the two,

Or between justice and injustice. Dinned

With war and argument I read no more

Than in the storm smoking along the wind

Athwart the wood. Two witches' cauldrons roar.

From one the weather shall rise clear and gay;

Out of the other an England beautiful

And like her mother that died yesterday.

Little I know or care if, being dull,

I shall miss something that historians

Can rake out of the ashes when perchance

The phoenix broods serene above their ken.

But with the best and meanest Englishmen

I am one in crying, God save England, lest

We lose what never slaves and cattle blessed.

The ages made her that made us from the dust:

She is all we know and live by, and we trust

She is good and must endure, loving her so:

And as we love ourselves we hate her foe.

naturelovedeathgrieffaithwaridentitytime
Public domain/Source

Read a new poem every day.

Poem A Day turns classic poetry into a quiet daily ritual, with saved poems and a calm reader built for returning.