Poem A Day

Classic poem

This Is No Case of Petty Right or Wrong

by Edward Thomas

THIS is no case of petty right or wrong

That politicians or philosophers

Can judge. I hate not Germans, nor grow hot

With love of Englishmen, to please newspapers.

Beside my hate for one fat patriot

My hatred of the Kaiser is love true:--

A kind of god he is, banging a gong.

But I have not to choose between the two,

Or between justice and injustice. Dinned

With war and argument I read no more

Than in the storm smoking along the wind

Athwart the wood. Two witches' cauldrons roar.

From one the weather shall rise clear and gay;

Out of the other an England beautiful

And like her mother that died yesterday.

Little I know or care if, being dull,

I shall miss something that historians

Can rake out of the ashes when perchance

The phoenix broods serene above their ken.

But with the best and meanest Englishmen

I am one in crying, God save England, lest

We lose what never slaves and cattle blessed.

The ages made her that made us from the dust:

She is all we know and live by, and we trust

She is good and must endure, loving her so:

And as we love ourselves we hate her foe.

naturelovedeathgrieffaithwaridentitytime
Public domain/Source

About this poem

First line
THIS is no case of petty right or wrong
Poet
Edward Thomas
Themes
nature, love, death, grief

Poem A Day

Save this poem in the app.

Favorite it in the app and get tomorrow's classic poem.