Poem A Day

Classic poem

There came a Day at Summer's full

by Emily Dickinson

There came a Day at Summer's full,

Entirely for me --

I thought that such were for the Saints,

Where Resurrections -- be --

The Sun, as common, went abroad,

The flowers, accustomed, blew,

As if no soul the solstice passed

That maketh all things new --

The time was scarce profaned, by speech --

The symbol of a word

Was needless, as at Sacrament,

The Wardrobe -- of our Lord --

Each was to each The Sealed Church,

Permitted to commune this -- time --

Lest we too awkward show

At Supper of the Lamb.

The Hours slid fast -- as Hours will,

Clutched tight, by greedy hands --

So faces on two Decks, look back,

Bound to opposing lands --

And so when all the time had leaked,

Without external sound

Each bound the Other's Crucifix --

We gave no other Bond --

Sufficient troth, that we shall rise --

Deposed -- at length, the Grave --

To that new Marriage,

Justified -- through Calvaries of Love --

naturelovedeathfaithwaridentitytimesea
Public domain/Source

About this poem

First line
There came a Day at Summer's full,
Poet
Emily Dickinson
Themes
nature, love, death, faith

Poem A Day

Save this poem in the app.

Favorite it in the app and get tomorrow's classic poem.