Poem A Day Open in app

Classic poem

There came a Day at Summer's full

by Emily Dickinson

There came a Day at Summer's full,

Entirely for me --

I thought that such were for the Saints,

Where Resurrections -- be --

The Sun, as common, went abroad,

The flowers, accustomed, blew,

As if no soul the solstice passed

That maketh all things new --

The time was scarce profaned, by speech --

The symbol of a word

Was needless, as at Sacrament,

The Wardrobe -- of our Lord --

Each was to each The Sealed Church,

Permitted to commune this -- time --

Lest we too awkward show

At Supper of the Lamb.

The Hours slid fast -- as Hours will,

Clutched tight, by greedy hands --

So faces on two Decks, look back,

Bound to opposing lands --

And so when all the time had leaked,

Without external sound

Each bound the Other's Crucifix --

We gave no other Bond --

Sufficient troth, that we shall rise --

Deposed -- at length, the Grave --

To that new Marriage,

Justified -- through Calvaries of Love --

naturelovedeathfaithwaridentitytimesea
Public domain/Source

Read a new poem every day.

Poem A Day turns classic poetry into a quiet daily ritual, with saved poems and a calm reader built for returning.